BIOT 202 Molecular Biology Lecture Notes PDF
Document Details
Uploaded by CleverRooster
null
Tags
Summary
These lecture notes provide a comprehensive overview of molecular biology, covering various aspects of proteins, including their structure, function, formation, and degradation, plus cellular processes.
Full Transcript
BIOT 202 – Molecular Biology Lecture Objectives Review: Genetic Code Review: 20 Amino Acids 20 Amino Acids Amino Acid Structure Peptide Bond Formation Breaking a Peptide Bond Peptide Bonds Peptide Bonds Lecture Objectives Protein Structure Primary Structure Secondary Struc...
BIOT 202 – Molecular Biology Lecture Objectives Review: Genetic Code Review: 20 Amino Acids 20 Amino Acids Amino Acid Structure Peptide Bond Formation Breaking a Peptide Bond Peptide Bonds Peptide Bonds Lecture Objectives Protein Structure Primary Structure Secondary Structure Secondary Structure Secondary Structure Tertiary Structure Quaternary Structure Protein Structure Summary Let’s Model a Protein Structure https://www.dnastar.com/workflows/protein-structure-prediction/ https://www.rcsb.org/ https://swissmodel.expasy.org/interactive TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAA PFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIK GKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDS KHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRK AVRRA Let’s Model a Protein Structure https://www.dnastar.com/workflows/protein-structure-prediction/ https://www.rcsb.org/ https://swissmodel.expasy.org/interactive MNGVSWSQDLQEGISAWFGPPASTPASTMSIRVTQKSYKVSTSGPRAFSSS YTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPL VLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQ KTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYED EINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIREL QSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEE LQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQR GELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLL EGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGA GSSSFSRTSSSRAVV VKKIETRDGKLVSESSDVLPK Lecture Objectives Protein Locations Visualizing Cellular Proteins Using Confocal Microscopy Organelle Interactome Video: https://cen.acs.org/articles/95/i22/Watching-organelles-bump.html Types of Protein Protein Processing Protein Processing Vesicles Exocytosis via Vesicles Endocytosis via Vesicles Endocytosis via Vesicles Proteins of the Plasma Membrane Classification of Membrane Transporters Lecture Objectives Post Translational Modifications of Proteins PTM: Ubiquitination PTM: Peptide Rearrangement via Disulfide Bonds PTM: Peptide Rearrangement via Disulfide Bonds PTM: Control Enzyme Activity (Next Week’s Class) Lecture Objectives Lysosome Peroxisomes Autophagy Lecture Objectives
